SCOPe 2.08: Domain d6o5mb2: 6o5m B:244-428

Lineage for d6o5mb2 (6o5m B:244-428)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (7 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [278816] (66 PDB entries)

8. Domain d6o5mb2: 6o5m B:244-428 [370987]
   Other proteins in same PDB: d6o5ma1, d6o5mb1, d6o5mc1, d6o5md1, d6o5me_, d6o5mf1, d6o5mf2, d6o5mf3
   automated match to d3rycd2
   complexed with acp, ca, g8k, gdp, gol, gtp, mes, mg

Details for d6o5mb2

PDB Entry: 6o5m, 2.3 Å

PDB Description: tubulin-rb3_sld-ttl in complex with compound 10bb

PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d6o5mb2:

Sequence; same for both SEQRES and ATOM records:

>d6o5mb2 d.79.2.1 (B:244-428) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqda

Timeline for d6o5mb2:

• d6o5mb2 first appeared in SCOPe 2.07