Lineage for d6o5me_ (6o5m E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733644Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2733915Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2733916Family a.137.10.1: Stathmin [101495] (2 proteins)
  6. 2733917Protein Stathmin 4 [101496] (3 species)
  7. 2733918Species Human (Homo sapiens) [TaxId:9606] [353877] (8 PDB entries)
  8. 2733920Domain d6o5me_: 6o5m E: [371115]
    Other proteins in same PDB: d6o5ma1, d6o5ma2, d6o5mb1, d6o5mb2, d6o5mc1, d6o5mc2, d6o5md1, d6o5md2, d6o5mf1, d6o5mf2, d6o5mf3
    automated match to d4i55e_
    complexed with acp, ca, g8k, gdp, gol, gtp, mes, mg

Details for d6o5me_

PDB Entry: 6o5m (more details), 2.3 Å

PDB Description: tubulin-rb3_sld-ttl in complex with compound 10bb
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d6o5me_:

Sequence, based on SEQRES records: (download)

>d6o5me_ a.137.10.1 (E:) Stathmin 4 {Human (Homo sapiens) [TaxId: 9606]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelk

Sequence, based on observed residues (ATOM records): (download)

>d6o5me_ a.137.10.1 (E:) Stathmin 4 {Human (Homo sapiens) [TaxId: 9606]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk

SCOPe Domain Coordinates for d6o5me_:

Click to download the PDB-style file with coordinates for d6o5me_.
(The format of our PDB-style files is described here.)

Timeline for d6o5me_: