| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.137.10: Stathmin [101494] (1 family) ![]() single long helix crosslinking four tubulin subunits automatically mapped to Pfam PF00836 |
| Family a.137.10.1: Stathmin [101495] (2 proteins) |
| Protein Stathmin 4 [101496] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [353877] (8 PDB entries) |
| Domain d6o5me_: 6o5m E: [371115] Other proteins in same PDB: d6o5ma1, d6o5ma2, d6o5mb1, d6o5mb2, d6o5mc1, d6o5mc2, d6o5md1, d6o5md2, d6o5mf1, d6o5mf2, d6o5mf3 automated match to d4i55e_ complexed with acp, ca, g8k, gdp, gol, gtp, mes, mg |
PDB Entry: 6o5m (more details), 2.3 Å
SCOPe Domain Sequences for d6o5me_:
Sequence, based on SEQRES records: (download)
>d6o5me_ a.137.10.1 (E:) Stathmin 4 {Human (Homo sapiens) [TaxId: 9606]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelk
>d6o5me_ a.137.10.1 (E:) Stathmin 4 {Human (Homo sapiens) [TaxId: 9606]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
Timeline for d6o5me_: