Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins) Pfam PF03133; PubMed 22020298 |
Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [311385] (176 PDB entries) |
Domain d6o5mf2: 6o5m F:77-378 [371009] Other proteins in same PDB: d6o5ma1, d6o5ma2, d6o5mb1, d6o5mb2, d6o5mc1, d6o5mc2, d6o5md1, d6o5md2, d6o5me_, d6o5mf1, d6o5mf3 automated match to d3tiia2 complexed with acp, ca, g8k, gdp, gol, gtp, mes, mg |
PDB Entry: 6o5m (more details), 2.3 Å
SCOPe Domain Sequences for d6o5mf2:
Sequence, based on SEQRES records: (download)
>d6o5mf2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi kl
>d6o5mf2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyprevflaaynrrregrgnvwialisseaseldfid eqgqvhviqkylekplllepghrkfdirswvlvdhlyniylyregvlrtssepynsanfq dktchltnhciqknygryeegnemffeefnqylmdalnttlensillqikhiirsclmci epaistkhlhyqsfqlfgfdfmvdeelkvwlievngapacaqklyaelcqgivdvaissv fplsifikl
Timeline for d6o5mf2: