Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) |
Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
Protein automated matches [190038] (49 species) not a true protein |
Species Plasmodium vivax [TaxId:5855] [234134] (20 PDB entries) |
Domain d6mb1c1: 6mb1 C:27-210 [370632] Other proteins in same PDB: d6mb1a3, d6mb1b3, d6mb1c3 automated match to d3iu1a1 complexed with cl, edo, jcy, so4, ync |
PDB Entry: 6mb1 (more details), 1.5 Å
SCOPe Domain Sequences for d6mb1c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6mb1c1 d.108.1.0 (C:27-210) automated matches {Plasmodium vivax [TaxId: 5855]} dykfwytqpvpkindefnesvnepfisdnkvedvrkdeyklppgyswyvcdvkdekdrse iytlltdnyvedddnifrfnysaefllwaltspnylktwhigvkydasnkligfisaipt dicihkrtikmaevnflcvhktlrskrlapvlikeitrrinleniwqaiytagvylpkpv sdar
Timeline for d6mb1c1: