Lineage for d6mb1b2 (6mb1 B:211-410)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969271Species Plasmodium vivax [TaxId:5855] [234134] (20 PDB entries)
  8. 2969293Domain d6mb1b2: 6mb1 B:211-410 [370603]
    Other proteins in same PDB: d6mb1a3, d6mb1b3, d6mb1c3
    automated match to d3iu1a2
    complexed with cl, edo, jcy, so4, ync

Details for d6mb1b2

PDB Entry: 6mb1 (more details), 1.5 Å

PDB Description: crystal structure of n-myristoyl transferase (nmt) from plasmodium vivax in complex with inhibitor imp-1002
PDB Compounds: (B:) Glycylpeptide N-tetradecanoyltransferase

SCOPe Domain Sequences for d6mb1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mb1b2 d.108.1.0 (B:211-410) automated matches {Plasmodium vivax [TaxId: 5855]}
yyhrsinvkklieigfsslnsrltmsraiklyrvedtlniknmrlmkkkdvegvhkllgs
yleqfnlyavftkeeiahwflpienviytyvneengkikdmisfyslpsqilgndkystl
naaysfynvtttatfkqlmqdaillakrnnfdvfnalevmqnksvfedlkfgegdgslky
ylynwkcasfapahvgivll

SCOPe Domain Coordinates for d6mb1b2:

Click to download the PDB-style file with coordinates for d6mb1b2.
(The format of our PDB-style files is described here.)

Timeline for d6mb1b2: