SCOPe 2.07: Domain d6mnoc2: 6mno C:82-178

Lineage for d6mnoc2 (6mno C:82-178)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species)

7. Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (31 PDB entries)
   probably orthologous to the human HLA-DQ group

8. Domain d6mnoc2: 6mno C:82-178 [370623]
   Other proteins in same PDB: d6mnoa1, d6mnoa2, d6mnob1, d6mnob2, d6mnoc1
   automated match to d1d9kc1

Details for d6mnoc2

PDB Entry: 6mno, 2.9 Å

PDB Description: 6235 tcr bound to i-ab padi4

PDB Compounds: (C:) H-2 class II histocompatibility antigen, A-B alpha chain

SCOPe Domain Sequences for d6mnoc2:

Sequence, based on SEQRES records:

>d6mnoc2 b.1.1.2 (C:82-178) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
atneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvadgvyetsffvnr
dysfhklsyltfipsdddiydckvehwgleepvlkhw

Sequence, based on observed residues (ATOM records):

>d6mnoc2 b.1.1.2 (C:82-178) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
atneapqatvfpkspvllgqpntlicfvdnifppvinitwnsksvadgvyetsffvnrdy
sfhklsyltfipsdydckvehwgleepvlkhw

Timeline for d6mnoc2:

• d6mnoc2 is new in SCOPe 2.07-stable