Lineage for d6mnoc2 (6mno C:82-178)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2747348Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species)
  7. 2747416Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (32 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 2747448Domain d6mnoc2: 6mno C:82-178 [370623]
    Other proteins in same PDB: d6mnoa1, d6mnoa2, d6mnob1, d6mnob2, d6mnoc1
    automated match to d1d9kc1

Details for d6mnoc2

PDB Entry: 6mno (more details), 2.9 Å

PDB Description: 6235 tcr bound to i-ab padi4
PDB Compounds: (C:) H-2 class II histocompatibility antigen, A-B alpha chain

SCOPe Domain Sequences for d6mnoc2:

Sequence, based on SEQRES records: (download)

>d6mnoc2 b.1.1.2 (C:82-178) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
atneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvadgvyetsffvnr
dysfhklsyltfipsdddiydckvehwgleepvlkhw

Sequence, based on observed residues (ATOM records): (download)

>d6mnoc2 b.1.1.2 (C:82-178) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
atneapqatvfpkspvllgqpntlicfvdnifppvinitwnsksvadgvyetsffvnrdy
sfhklsyltfipsdydckvehwgleepvlkhw

SCOPe Domain Coordinates for d6mnoc2:

Click to download the PDB-style file with coordinates for d6mnoc2.
(The format of our PDB-style files is described here.)

Timeline for d6mnoc2: