| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species) |
| Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (32 PDB entries) probably orthologous to the human HLA-DQ group |
| Domain d6mnoc2: 6mno C:82-178 [370623] Other proteins in same PDB: d6mnoa1, d6mnoa2, d6mnob1, d6mnob2, d6mnoc1 automated match to d1d9kc1 |
PDB Entry: 6mno (more details), 2.9 Å
SCOPe Domain Sequences for d6mnoc2:
Sequence, based on SEQRES records: (download)
>d6mnoc2 b.1.1.2 (C:82-178) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
atneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvadgvyetsffvnr
dysfhklsyltfipsdddiydckvehwgleepvlkhw
>d6mnoc2 b.1.1.2 (C:82-178) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
atneapqatvfpkspvllgqpntlicfvdnifppvinitwnsksvadgvyetsffvnrdy
sfhklsyltfipsdydckvehwgleepvlkhw
Timeline for d6mnoc2:
View in 3DDomains from other chains: (mouse over for more information) d6mnoa1, d6mnoa2, d6mnob1, d6mnob2 |