Lineage for d6mnob2 (6mno B:112-239)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2753278Domain d6mnob2: 6mno B:112-239 [370626]
    Other proteins in same PDB: d6mnoa1, d6mnob1, d6mnoc1, d6mnoc2
    automated match to d4dzbb2

Details for d6mnob2

PDB Entry: 6mno (more details), 2.9 Å

PDB Description: 6235 tcr bound to i-ab padi4
PDB Compounds: (B:) 6235 TCR beta chain

SCOPe Domain Sequences for d6mnob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mnob2 b.1.1.2 (B:112-239) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

SCOPe Domain Coordinates for d6mnob2:

Click to download the PDB-style file with coordinates for d6mnob2.
(The format of our PDB-style files is described here.)

Timeline for d6mnob2: