| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species) |
| Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (32 PDB entries) probably orthologous to the human HLA-DQ group |
| Domain d1d9kc1: 1d9k C:82-182 [21627] Other proteins in same PDB: d1d9ka_, d1d9kb_, d1d9kc2, d1d9kd1, d1d9kd2, d1d9ke_, d1d9kf_, d1d9kg2, d1d9kh1, d1d9kh2 complexed with nag |
PDB Entry: 1d9k (more details), 3.2 Å
SCOPe Domain Sequences for d1d9kc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d9kc1 b.1.1.2 (C:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
atneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsffvnr
dysfhklsyltfipsdddiydckvehwgleepvlkhwepei
Timeline for d1d9kc1: