Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (23 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.1: Papain-like [54002] (26 proteins) |
Protein (Pro)cathepsin B [54022] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [54023] (6 PDB entries) |
Domain d1csb.2: 1csb D:,E: [37052] complexed with ep0 |
PDB Entry: 1csb (more details), 2 Å
SCOPe Domain Sequences for d1csb.2:
Sequence; same for both SEQRES and ATOM records: (download)
>g1csb.2 d.3.1.1 (D:,E:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} lpasfdareqwpqcptikeirdqgscgscwafgaveaisdricihtnXvsvevsaedllt ccgsmcgdgcnggypaeawnfwtrkglvsgglyeshvgcrpysippcehhvngsrppctg egdtpkcskicepgysptykqdkhygynsysvsnsekdimaeiykngpvegafsvysdfl lyksgvyqhvtgemmgghairilgwgvengtpywlvanswntdwgdngffkilrgqdhcg iesevvagiprtd
Timeline for d1csb.2:
View in 3D Domains from other chains: (mouse over for more information) d1csb.1, d1csb.1, d1csb.1, d1csb.1 |