Lineage for d1csb.2 (1csb D:,E:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1191813Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1191814Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1191815Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 1191816Protein (Pro)cathepsin B [54022] (3 species)
  7. 1191821Species Human (Homo sapiens) [TaxId:9606] [54023] (6 PDB entries)
  8. 1191828Domain d1csb.2: 1csb D:,E: [37052]
    complexed with ep0

Details for d1csb.2

PDB Entry: 1csb (more details), 2 Å

PDB Description: Crystal structure of cathepsin b inhibited with CA030 at 2.1 angstroms resolution: A basis for the design of specific epoxysuccinyl inhibitors
PDB Compounds: (D:) CATHEPSIN B light chain, (E:) CATHEPSIN B heavy chain

SCOPe Domain Sequences for d1csb.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1csb.2 d.3.1.1 (D:,E:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]}
lpasfdareqwpqcptikeirdqgscgscwafgaveaisdricihtnXvsvevsaedllt
ccgsmcgdgcnggypaeawnfwtrkglvsgglyeshvgcrpysippcehhvngsrppctg
egdtpkcskicepgysptykqdkhygynsysvsnsekdimaeiykngpvegafsvysdfl
lyksgvyqhvtgemmgghairilgwgvengtpywlvanswntdwgdngffkilrgqdhcg
iesevvagiprtd

SCOPe Domain Coordinates for d1csb.2:

Click to download the PDB-style file with coordinates for d1csb.2.
(The format of our PDB-style files is described here.)

Timeline for d1csb.2: