SCOP 1.75: Domain d1csb.2: 1csb D:,E:

Lineage for d1csb.2 (1csb D:,E:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (22 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (25 proteins)

6. Protein (Pro)cathepsin B [54022] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54023] (6 PDB entries)

8. Domain d1csb.2: 1csb D:,E: [37052]
   complexed with eox, epo

Details for d1csb.2

PDB Entry: 1csb, 2 Å

PDB Description: Crystal structure of cathepsin b inhibited with CA030 at 2.1 angstroms resolution: A basis for the design of specific epoxysuccinyl inhibitors

PDB Compounds: (D:) cathepsin b, (E:) cathepsin b

SCOP Domain Sequences for d1csb.2:

Sequence; same for both SEQRES and ATOM records:

>g1csb.2 d.3.1.1 (D:,E:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]}
lpasfdareqwpqcptikeirdqgscgscwafgaveaisdricihtnXvsvevsaedllt
ccgsmcgdgcnggypaeawnfwtrkglvsgglyeshvgcrpysippcehhvngsrppctg
egdtpkcskicepgysptykqdkhygynsysvsnsekdimaeiykngpvegafsvysdfl
lyksgvyqhvtgemmgghairilgwgvengtpywlvanswntdwgdngffkilrgqdhcg
iesevvagiprtd

Timeline for d1csb.2:

• d1csb.2 first appeared (with stable ids) in SCOP 1.55
  
• d1csb.2 appears in SCOP 1.73
  
• d1csb.2 appears in SCOPe 2.01
  
• d1csb.2 appears in the current release, SCOPe 2.08