Lineage for d6hayh_ (6hay H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2931223Protein Elongin B [54246] (2 species)
  7. 2931224Species Human (Homo sapiens) [TaxId:9606] [54247] (53 PDB entries)
  8. 2931298Domain d6hayh_: 6hay H: [370113]
    Other proteins in same PDB: d6haya_, d6hayb_, d6hayc1, d6hayc2, d6haye_, d6hayf_, d6hayg1, d6hayg2
    automated match to d1lqba_
    complexed with edo, epe, fmt, fx8

Details for d6hayh_

PDB Entry: 6hay (more details), 2.24 Å

PDB Description: crystal structure of protac 1 in complex with the bromodomain of human smarca2 and pvhl:elonginc:elonginb
PDB Compounds: (H:) Elongin-B

SCOPe Domain Sequences for d6hayh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hayh_ d.15.1.1 (H:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvm

SCOPe Domain Coordinates for d6hayh_:

Click to download the PDB-style file with coordinates for d6hayh_.
(The format of our PDB-style files is described here.)

Timeline for d6hayh_: