| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
| Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
| Protein Elongin B [54246] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [54247] (53 PDB entries) |
| Domain d6hayh_: 6hay H: [370113] Other proteins in same PDB: d6haya_, d6hayb_, d6hayc1, d6hayc2, d6haye_, d6hayf_, d6hayg1, d6hayg2 automated match to d1lqba_ complexed with edo, epe, fmt, fx8 |
PDB Entry: 6hay (more details), 2.24 Å
SCOPe Domain Sequences for d6hayh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hayh_ d.15.1.1 (H:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvm
Timeline for d6hayh_: