SCOPe 2.08: Domain d6hayb_: 6hay B:

Lineage for d6hayb_ (6hay B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.3: VHL [49468] (1 family)
   automatically mapped to Pfam PF01847

5. Family b.3.3.1: VHL [49469] (2 proteins)

6. Protein VHL [49470] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49471] (41 PDB entries)

8. Domain d6hayb_: 6hay B: [370110]
   Other proteins in same PDB: d6haya_, d6hayc1, d6hayc2, d6hayd_, d6haye_, d6hayg1, d6hayg2, d6hayh_
   automated match to d1lqbc_
   complexed with edo, epe, fmt, fx8

Details for d6hayb_

PDB Entry: 6hay, 2.24 Å

PDB Description: crystal structure of protac 1 in complex with the bromodomain of human smarca2 and pvhl:elonginc:elonginb

PDB Compounds: (B:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d6hayb_:

Sequence; same for both SEQRES and ATOM records:

>d6hayb_ b.3.3.1 (B:) VHL {Human (Homo sapiens) [TaxId: 9606]}
prpvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwl
frdagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrl
divrslyedledhpnvqkdlerltqeriahqr

Timeline for d6hayb_:

• d6hayb_ first appeared in SCOPe 2.07