Class a: All alpha proteins [46456] (290 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) |
Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
Protein automated matches [190615] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries) |
Domain d6haya_: 6hay A: [370086] Other proteins in same PDB: d6hayb_, d6hayc1, d6hayc2, d6hayd_, d6hayf_, d6hayg1, d6hayg2, d6hayh_ automated match to d2grca_ complexed with edo, epe, fmt, fx8 |
PDB Entry: 6hay (more details), 2.24 Å
SCOPe Domain Sequences for d6haya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6haya_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} eklspnppkltkqmnaiidtvinykdssgrqlsevfiqlpsrkelpeyyelirkpvdfkk ikerirnhkyrslgdlekdvmllchnaqtfnlegsqiyedsivlqsvfksarqkiakeee
Timeline for d6haya_: