Lineage for d6gsoc_ (6gso C:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. Protein automated matches [190095] (28 species)
    not a true protein
  7. Species Sulfolobus solfataricus [TaxId:2287] [195677] (7 PDB entries)
  8. Domain d6gsoc_: 6gso C: [370028]
    automated match to d1w3ia_
    complexed with edo, gol

Details for d6gsoc_

PDB Entry: 6gso (more details), 2 Å

PDB Description: sulfolobus solfataricus 2-keto-3-deoxygluconate aldolase y132v,t157c variant
PDB Compounds: (C:) 2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate aldolase

SCOPe Domain Sequences for d6gsoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gsoc_ c.1.10.1 (C:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
peiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlka
vydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlce
vsphpvylynvptatgkdidakvakeigcftgvkdcieniihtldykrlnpnmlvysgsd
mliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifgs
lssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke

SCOPe Domain Coordinates for d6gsoc_ are not available.

Timeline for d6gsoc_:

Domains from other chains:
(mouse over for more information)
d6gsoa_, d6gsob_, d6gsod_