Lineage for d1w3ia_ (1w3i A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. Protein 2-keto-3-deoxy gluconate aldolase Eda [110360] (1 species)
  7. Species Sulfolobus solfataricus [TaxId:2287] [110361] (5 PDB entries)
    Uniprot Q97U28
  8. Domain d1w3ia_: 1w3i A: [109152]
    complexed with gol, pyr
    has additional insertions and/or extensions that are not grouped together

Details for d1w3ia_

PDB Entry: 1w3i (more details), 1.7000000000000002 Å

PDB Description: sulfolobus solfataricus 2-keto-3-deoxygluconate (kdg) aldolase complex with pyruvate
PDB Compounds: (A:) 2-keto-3-deoxy gluconate aldolase

SCOPe Domain Sequences for d1w3ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w3ia_ c.1.10.1 (A:) 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus solfataricus [TaxId: 2287]}
peiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlka
vydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlce
vsphpvylynyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgsd
mliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifgs
lssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke

SCOPe Domain Coordinates for d1w3ia_ are not available.

Timeline for d1w3ia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1w3ib_, d1w3ic_, d1w3id_