PDB entry 6gso

View 6gso on RCSB PDB site
Description: Sulfolobus solfataricus 2-keto-3-deoxygluconate aldolase Y132V,T157C variant
Class: hydrolase
Keywords: 2-keto-3-deoxygluconate, aldolase, Sulfolobus solfataricus, HYDROLASE
Deposited on 2018-06-15, released 2019-06-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-26, with a file datestamp of 2019-06-21.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate aldolase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O54288 (0-292)
      • engineered mutation (130)
      • engineered mutation (155)
    Domains in SCOPe 2.07: d6gsoa_
  • Chain 'B':
    Compound: 2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate aldolase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O54288 (0-292)
      • engineered mutation (130)
      • engineered mutation (155)
    Domains in SCOPe 2.07: d6gsob_
  • Chain 'C':
    Compound: 2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate aldolase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O54288 (0-292)
      • engineered mutation (130)
      • engineered mutation (155)
    Domains in SCOPe 2.07: d6gsoc_
  • Chain 'D':
    Compound: 2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate aldolase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O54288 (0-292)
      • engineered mutation (130)
      • engineered mutation (155)
    Domains in SCOPe 2.07: d6gsod_
  • Heterogens: EDO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gsoA (A:)
    peiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlka
    vydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlce
    vsphpvylynvptatgkdidakvakeigcftgvkdcieniihtldykrlnpnmlvysgsd
    mliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifgs
    lssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gsoB (B:)
    peiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlka
    vydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlce
    vsphpvylynvptatgkdidakvakeigcftgvkdcieniihtldykrlnpnmlvysgsd
    mliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifgs
    lssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gsoC (C:)
    peiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlka
    vydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlce
    vsphpvylynvptatgkdidakvakeigcftgvkdcieniihtldykrlnpnmlvysgsd
    mliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifgs
    lssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6gsoD (D:)
    peiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlka
    vydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlce
    vsphpvylynvptatgkdidakvakeigcftgvkdcieniihtldykrlnpnmlvysgsd
    mliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifgs
    lssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke