Lineage for d6d4pa1 (6d4p A:1-147)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2507728Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2507729Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2507730Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2507955Protein automated matches [190124] (13 species)
    not a true protein
  7. 2507970Species Human (Homo sapiens) [TaxId:9606] [186848] (53 PDB entries)
  8. 3069617Domain d6d4pa1: 6d4p A:1-147 [369679]
    Other proteins in same PDB: d6d4pa2, d6d4pc1, d6d4pc2
    automated match to d2c4pa_

Details for d6d4pa1

PDB Entry: 6d4p (more details), 2.11 Å

PDB Description: ube2d1 in complex with ubiquitin variant ubv.d1.1
PDB Compounds: (A:) ubiquitin-conjugating enzyme e2 d1

SCOPe Domain Sequences for d6d4pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d4pa1 d.20.1.1 (A:1-147) automated matches {Human (Homo sapiens) [TaxId: 9606]}
malkriqkelsdlqrdppahcsagpvgddlfhwqatimgppdsayqggvffltvhfptdy
pfkppkiafttkiyhpninsngsicldilrsqwspaltvskvllsicsllcdpnpddplv
pdiaqiyksdkekynrharewtqkyam

SCOPe Domain Coordinates for d6d4pa1:

Click to download the PDB-style file with coordinates for d6d4pa1.
(The format of our PDB-style files is described here.)

Timeline for d6d4pa1:

  • d6d4pa1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6d4pa2