Lineage for d6aeha2 (6aeh A:231-289)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2716398Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2716677Family a.60.12.0: automated matches [254215] (1 protein)
    not a true family
  6. 2716678Protein automated matches [254483] (3 species)
    not a true protein
  7. 2716679Species Human (Homo sapiens) [TaxId:9606] [255047] (17 PDB entries)
  8. 2716684Domain d6aeha2: 6aeh A:231-289 [369279]
    Other proteins in same PDB: d6aeha1, d6aeha3
    automated match to d4lzda2
    protein/DNA complex; complexed with mn, so4, utp

Details for d6aeha2

PDB Entry: 6aeh (more details), 1.64 Å

PDB Description: binary complex of human dna polymerase mu with mnutp
PDB Compounds: (A:) DNA-directed DNA/RNA polymerase mu

SCOPe Domain Sequences for d6aeha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aeha2 a.60.12.0 (A:231-289) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seryqtmklftqifgvgvktadrwyreglrtlddlreqpqkltqqqkaglqhhqdlstp

SCOPe Domain Coordinates for d6aeha2:

Click to download the PDB-style file with coordinates for d6aeha2.
(The format of our PDB-style files is described here.)

Timeline for d6aeha2: