![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.26: SMAD/FHA domain [49878] (1 superfamily) sandwich; 11 strands in 2 sheets; greek-key |
![]() | Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) ![]() has a few short helices inserted in loops |
![]() | Family b.26.1.0: automated matches [191616] (1 protein) not a true family |
![]() | Protein automated matches [191125] (8 species) not a true protein |
![]() | Species Mycobacterium smegmatis [TaxId:246196] [231587] (3 PDB entries) |
![]() | Domain d6i2qb_: 6i2q B: [369113] automated match to d4qcja_ complexed with ca, mg, tpp |
PDB Entry: 6i2q (more details), 2.15 Å
SCOPe Domain Sequences for d6i2qb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6i2qb_ b.26.1.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 246196]} psgsallvvkrgpnagsrflldqpttsagrhpdsdiflddvtvsrrhaefrleggefqvv dvgslngtyvnrepvdsavlangdevqigkfrlvflt
Timeline for d6i2qb_: