Lineage for d6i2qb_ (6i2q B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778062Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 2778063Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 2778206Family b.26.1.0: automated matches [191616] (1 protein)
    not a true family
  6. 2778207Protein automated matches [191125] (8 species)
    not a true protein
  7. 2778233Species Mycobacterium smegmatis [TaxId:246196] [231587] (3 PDB entries)
  8. 2778234Domain d6i2qb_: 6i2q B: [369113]
    automated match to d4qcja_
    complexed with ca, mg, tpp

Details for d6i2qb_

PDB Entry: 6i2q (more details), 2.15 Å

PDB Description: crystal structure of the wild-type suca domain of mycobacterium smegmatis kgd (alpha-ketoglutarate decarboxylase), in complex with gara
PDB Compounds: (B:) Glycogen accumulation regulator GarA

SCOPe Domain Sequences for d6i2qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i2qb_ b.26.1.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
psgsallvvkrgpnagsrflldqpttsagrhpdsdiflddvtvsrrhaefrleggefqvv
dvgslngtyvnrepvdsavlangdevqigkfrlvflt

SCOPe Domain Coordinates for d6i2qb_:

Click to download the PDB-style file with coordinates for d6i2qb_.
(The format of our PDB-style files is described here.)

Timeline for d6i2qb_: