PDB entry 6i2q

View 6i2q on RCSB PDB site
Description: Crystal structure of the wild-type SucA domain of Mycobacterium smegmatis KGD (alpha-ketoglutarate decarboxylase), in complex with GarA
Class: oxidoreductase
Keywords: oxoglutarate dehydrogenase, decarboxylase, OXIDOREDUCTASE
Deposited on 2018-11-01, released 2019-05-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: multifunctional 2-oxoglutarate metabolism enzyme
    Species: Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) [TaxId:246196]
    Gene: kgd, sucA, MSMEG_5049, MSMEI_4922
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Glycogen accumulation regulator GarA
    Species: Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) [TaxId:246196]
    Gene: garA, MSMEG_3647, MSMEI_3561
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6i2qb_
  • Heterogens: TPP, MG, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6i2qB (B:)
    gsgveglpsgsallvvkrgpnagsrflldqpttsagrhpdsdiflddvtvsrrhaefrle
    ggefqvvdvgslngtyvnrepvdsavlangdevqigkfrlvfltgpksddsgsna
    

    Sequence, based on observed residues (ATOM records): (download)
    >6i2qB (B:)
    psgsallvvkrgpnagsrflldqpttsagrhpdsdiflddvtvsrrhaefrleggefqvv
    dvgslngtyvnrepvdsavlangdevqigkfrlvflt