SCOPe 2.08: Domain d6dgub_: 6dgu B:

Lineage for d6dgub_ (6dgu B:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein automated matches [190161] (29 species)
   not a true protein

7. Species Citrobacter freundii [TaxId:546] [235913] (4 PDB entries)

8. Domain d6dgub_: 6dgu B: [369076]
   automated match to d3znwb_

Details for d6dgub_

PDB Entry: 6dgu, 2.69 Å

PDB Description: per-2 class a extended-spectrum beta-lactamase crystal structure at 2.69 angstrom resolution

PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d6dgub_:

Sequence; same for both SEQRES and ATOM records:

>d6dgub_ e.3.1.1 (B:) automated matches {Citrobacter freundii [TaxId: 546]}
spllkeqietivtgkkatvgvavwgpddleplllnpfekfpmqsvfklhlamlvlhqvdq
gkldlnqsvtvnraavlqntwspmmkdhqgdeftvavqqllqysvshsdnvacdllfelv
ggpqalhayiqslgvkeaavvaneaqmhaddqvqyqnwtsmkaaaqvlqkfeqkkqlset
sqallwkwmvetttgpqrlkgllpagtivahktgtsgvragktaatndagvimlpdgrpl
lvavfvkdsaesertneaiiaqvaqaayqfelkklsa

Timeline for d6dgub_:

• d6dgub_ first appeared in SCOPe 2.07