Lineage for d6dgub_ (6dgu B:)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. Protein automated matches [190161] (29 species)
    not a true protein
  7. Species Citrobacter freundii [TaxId:546] [235913] (4 PDB entries)
  8. Domain d6dgub_: 6dgu B: [369076]
    automated match to d3znwb_

Details for d6dgub_

PDB Entry: 6dgu (more details), 2.69 Å

PDB Description: per-2 class a extended-spectrum beta-lactamase crystal structure at 2.69 angstrom resolution
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d6dgub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dgub_ e.3.1.1 (B:) automated matches {Citrobacter freundii [TaxId: 546]}
spllkeqietivtgkkatvgvavwgpddleplllnpfekfpmqsvfklhlamlvlhqvdq
gkldlnqsvtvnraavlqntwspmmkdhqgdeftvavqqllqysvshsdnvacdllfelv
ggpqalhayiqslgvkeaavvaneaqmhaddqvqyqnwtsmkaaaqvlqkfeqkkqlset
sqallwkwmvetttgpqrlkgllpagtivahktgtsgvragktaatndagvimlpdgrpl
lvavfvkdsaesertneaiiaqvaqaayqfelkklsa

SCOPe Domain Coordinates for d6dgub_ are not available.

Timeline for d6dgub_:

Domains from other chains:
(mouse over for more information)
d6dgua_, d6dguc_, d6dgud_