Lineage for d3znwb_ (3znw B:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3012720Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3013567Protein automated matches [190161] (29 species)
    not a true protein
  7. 3013606Species Citrobacter freundii [TaxId:546] [235913] (4 PDB entries)
  8. 3013608Domain d3znwb_: 3znw B: [306984]
    automated match to d4d2oa_

Details for d3znwb_

PDB Entry: 3znw (more details), 2.09 Å

PDB Description: Crystal structure of the class A extended-spectrum beta-lactamase PER- 2
PDB Compounds: (B:) extended-spectrum beta-lactamase

SCOPe Domain Sequences for d3znwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3znwb_ e.3.1.1 (B:) automated matches {Citrobacter freundii [TaxId: 546]}
spllkeqietivtgkkatvgvavwgpddleplllnpfekfpmqsvfklhlamlvlhqvdq
gkldlnqsvtvnraavlqntwspmmkdhqgdeftvavqqllqysvshsdnvacdllfelv
ggpqalhayiqslgvkeaavvaneaqmhaddqvqyqnwtsmkaaaqvlqkfeqkkqlset
sqallwkwmvetttgpqrlkgllpagtivahktgtsgvragktaatndagvimlpdgrpl
lvavfvkdsaesertneaiiaqvaqaayqfelkklsav

SCOPe Domain Coordinates for d3znwb_:

Click to download the PDB-style file with coordinates for d3znwb_.
(The format of our PDB-style files is described here.)

Timeline for d3znwb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3znwa_