PDB entry 6dgu

View 6dgu on RCSB PDB site
Description: PER-2 class A extended-spectrum beta-lactamase crystal structure at 2.69 Angstrom resolution
Class: hydrolase
Keywords: penicilloil-serine-transferase, antibiotic resistance, HYDROLASE
Deposited on 2018-05-18, released 2019-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Citrobacter freundii [TaxId:546]
    Gene: blaPER-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dgua_
  • Chain 'B':
    Compound: Beta-lactamase
    Species: Citrobacter freundii [TaxId:546]
    Gene: blaPER-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dgub_
  • Chain 'C':
    Compound: Beta-lactamase
    Species: Citrobacter freundii [TaxId:546]
    Gene: blaPER-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dguc_
  • Chain 'D':
    Compound: Beta-lactamase
    Species: Citrobacter freundii [TaxId:546]
    Gene: blaPER-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dgud_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dguA (A:)
    spllkeqietivtgkkatvgvavwgpddleplllnpfekfpmqsvfklhlamlvlhqvdq
    gkldlnqsvtvnraavlqntwspmmkdhqgdeftvavqqllqysvshsdnvacdllfelv
    ggpqalhayiqslgvkeaavvaneaqmhaddqvqyqnwtsmkaaaqvlqkfeqkkqlset
    sqallwkwmvetttgpqrlkgllpagtivahktgtsgvragktaatndagvimlpdgrpl
    lvavfvkdsaesertneaiiaqvaqaayqfelkklsavspd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dguA (A:)
    spllkeqietivtgkkatvgvavwgpddleplllnpfekfpmqsvfklhlamlvlhqvdq
    gkldlnqsvtvnraavlqntwspmmkdhqgdeftvavqqllqysvshsdnvacdllfelv
    ggpqalhayiqslgvkeaavvaneaqmhaddqvqyqnwtsmkaaaqvlqkfeqkkqlset
    sqallwkwmvetttgpqrlkgllpagtivahktgtsgvragktaatndagvimlpdgrpl
    lvavfvkdsaesertneaiiaqvaqaayqfelkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dguB (B:)
    spllkeqietivtgkkatvgvavwgpddleplllnpfekfpmqsvfklhlamlvlhqvdq
    gkldlnqsvtvnraavlqntwspmmkdhqgdeftvavqqllqysvshsdnvacdllfelv
    ggpqalhayiqslgvkeaavvaneaqmhaddqvqyqnwtsmkaaaqvlqkfeqkkqlset
    sqallwkwmvetttgpqrlkgllpagtivahktgtsgvragktaatndagvimlpdgrpl
    lvavfvkdsaesertneaiiaqvaqaayqfelkklsavspd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dguB (B:)
    spllkeqietivtgkkatvgvavwgpddleplllnpfekfpmqsvfklhlamlvlhqvdq
    gkldlnqsvtvnraavlqntwspmmkdhqgdeftvavqqllqysvshsdnvacdllfelv
    ggpqalhayiqslgvkeaavvaneaqmhaddqvqyqnwtsmkaaaqvlqkfeqkkqlset
    sqallwkwmvetttgpqrlkgllpagtivahktgtsgvragktaatndagvimlpdgrpl
    lvavfvkdsaesertneaiiaqvaqaayqfelkklsa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6dguC (C:)
    spllkeqietivtgkkatvgvavwgpddleplllnpfekfpmqsvfklhlamlvlhqvdq
    gkldlnqsvtvnraavlqntwspmmkdhqgdeftvavqqllqysvshsdnvacdllfelv
    ggpqalhayiqslgvkeaavvaneaqmhaddqvqyqnwtsmkaaaqvlqkfeqkkqlset
    sqallwkwmvetttgpqrlkgllpagtivahktgtsgvragktaatndagvimlpdgrpl
    lvavfvkdsaesertneaiiaqvaqaayqfelkklsavspd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dguC (C:)
    spllkeqietivtgkkatvgvavwgpddleplllnpfekfpmqsvfklhlamlvlhqvdq
    gkldlnqsvtvnraavlqntwspmmkdhqgdeftvavqqllqysvshsdnvacdllfelv
    ggpqalhayiqslgvkeaavvaneaqmhaddqvqyqnwtsmkaaaqvlqkfeqkkqlset
    sqallwkwmvetttgpqrlkgllpagtivahktgtsgvragktaatndagvimlpdgrpl
    lvavfvkdsaesertneaiiaqvaqaayqfelkkl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6dguD (D:)
    spllkeqietivtgkkatvgvavwgpddleplllnpfekfpmqsvfklhlamlvlhqvdq
    gkldlnqsvtvnraavlqntwspmmkdhqgdeftvavqqllqysvshsdnvacdllfelv
    ggpqalhayiqslgvkeaavvaneaqmhaddqvqyqnwtsmkaaaqvlqkfeqkkqlset
    sqallwkwmvetttgpqrlkgllpagtivahktgtsgvragktaatndagvimlpdgrpl
    lvavfvkdsaesertneaiiaqvaqaayqfelkklsavspd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dguD (D:)
    llkeqietivtgkkatvgvavwgpddleplllnpfekfpmqsvfklhlamlvlhqvdqgk
    ldlnqsvtvnraavlqntwspmmkdhqgdeftvavqqllqysvshsdnvacdllfelvgg
    pqalhayiqslgvkeaavvaneaqmhaddqvqyqnwtsmkaaaqvlqkfeqkkqlsetsq
    allwkwmvetttgpqrlkgllpagtivahktgtsgvragktaatndagvimlpdgrpllv
    avfvkdsaesertneaiiaqvaqaayqfelkk