SCOPe 2.07: Domain d6n9db_: 6n9d B:

Lineage for d6n9db_ (6n9d B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.3: TIMP-like [50242] (4 families)

5. Family b.40.3.1: Tissue inhibitor of metalloproteinases, TIMP [50243] (2 proteins)
   contains an irregular alpha+beta subdomain in the C-terminal extension
   automatically mapped to Pfam PF00965

6. Protein TIMP-1 [50244] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50245] (8 PDB entries)

8. Domain d6n9db_: 6n9d B: [368975]
   Other proteins in same PDB: d6n9da_
   automated match to d1ueab_
   complexed with ca, zn; mutant

Details for d6n9db_

PDB Entry: 6n9d, 2.67 Å

PDB Description: complex of tissue inhibitor of metalloproteinases-1 (timp-1) mutant (l34g/l133p/l151c/g154a) with matrix metalloproteinase-3 catalytic domain (mmp-3cd)

PDB Compounds: (B:) Metalloproteinase inhibitor 1

SCOPe Domain Sequences for d6n9db_:

Sequence, based on SEQRES records:

>d6n9db_ b.40.3.1 (B:) TIMP-1 {Human (Homo sapiens) [TaxId: 9606]}
ctcvpphpqtafcnsdlvirakfvgtpevnqttgyqryeikmtkmykgfqalgdaadirf
vytpamesvcgyfhrshnrseefliagklqdgllhittcsfvapwnslslaqrrgftkty
tvgceectvfpcpsipcklqsgthclwtdqclqasekgfqsrhlaclprepglctwqsl

Sequence, based on observed residues (ATOM records):

>d6n9db_ b.40.3.1 (B:) TIMP-1 {Human (Homo sapiens) [TaxId: 9606]}
ctcvpphpqtafcnsdlvirakfvgtpevnqttgyqryeikmtkmykgfqaldirfvytp
amesvcgyfhrshnrseefliagklqdgllhittcsfvapwnslslaqrrgftktytvgc
eectvfpcpsipcklqsgthclwtdqclqasekgfqsrhlaclprepglctwqsl

Timeline for d6n9db_:

• d6n9db_ is new in SCOPe 2.07-stable
  
• d6n9db_ appears in the current release, SCOPe 2.08