Lineage for d1ueab_ (1uea B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398847Superfamily b.40.3: TIMP-like [50242] (4 families) (S)
  5. 2398848Family b.40.3.1: Tissue inhibitor of metalloproteinases, TIMP [50243] (2 proteins)
    contains an irregular alpha+beta subdomain in the C-terminal extension
    automatically mapped to Pfam PF00965
  6. 2398849Protein TIMP-1 [50244] (1 species)
  7. 2398850Species Human (Homo sapiens) [TaxId:9606] [50245] (8 PDB entries)
  8. 2398857Domain d1ueab_: 1uea B: [25232]
    Other proteins in same PDB: d1ueaa_, d1ueac_
    complexed with ca, zn

Details for d1ueab_

PDB Entry: 1uea (more details), 2.8 Å

PDB Description: mmp-3/timp-1 complex
PDB Compounds: (B:) tissue inhibitor of metalloproteinase-1

SCOPe Domain Sequences for d1ueab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ueab_ b.40.3.1 (B:) TIMP-1 {Human (Homo sapiens) [TaxId: 9606]}
ctcvpphpqtafcnsdlvirakfvgtpevaqttlyqryeikmtkmykgfqalgdaadirf
vytpamesvcgyfhrsharseefliagklqdgllhittcsfvapwnslslaqrrgftkty
tvgceectvfpclsipcklqsgthclwtdqllqgsekgfqsrhlaclprepglctwqslr
s

SCOPe Domain Coordinates for d1ueab_:

Click to download the PDB-style file with coordinates for d1ueab_.
(The format of our PDB-style files is described here.)

Timeline for d1ueab_: