SCOPe 2.07: Domain d6n9da_: 6n9d A:

Lineage for d6n9da_ (6n9d A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Stromelysin-1 (MMP-3) [55536] (1 species)

7. Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (42 PDB entries)

8. Domain d6n9da_: 6n9d A: [368916]
   Other proteins in same PDB: d6n9db_
   automated match to d2usna_
   complexed with ca, zn; mutant

Details for d6n9da_

PDB Entry: 6n9d, 2.67 Å

PDB Description: complex of tissue inhibitor of metalloproteinases-1 (timp-1) mutant (l34g/l133p/l151c/g154a) with matrix metalloproteinase-3 catalytic domain (mmp-3cd)

PDB Compounds: (A:) stromelysin-1

SCOPe Domain Sequences for d6n9da_:

Sequence; same for both SEQRES and ATOM records:

>d6n9da_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
pgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadimisf
avrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaaheighs
lglfhsantealmyplyhsltdltrfrlsqddingiqslyg

Timeline for d6n9da_:

• d6n9da_ is new in SCOPe 2.07-stable
  
• d6n9da_ appears in the current release, SCOPe 2.08