SCOPe 2.08: Domain d6gf3a2: 6gf3 A:246-437

Lineage for d6gf3a2 (6gf3 A:246-437)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
Protein automated matches [227071] (7 species)
not a true protein
Species Cow (Bos taurus) [TaxId:9913] [226565] (136 PDB entries)
Domain d6gf3a2: 6gf3 A:246-437 [368529]
Other proteins in same PDB: d6gf3a1, d6gf3b1, d6gf3c1, d6gf3d1, d6gf3e_, d6gf3f1
automated match to d4i50a2
complexed with acp, ca, edo, ex5, gdp, gtp, mes, mg

Details for d6gf3a2

PDB Entry: 6gf3 (more details), 2.4 Å

PDB Description: tubulin-jerantinine b acetate complex

PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d6gf3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gf3a2 d.79.2.1 (A:246-437) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgv

SCOPe Domain Coordinates for d6gf3a2:

Click to download the PDB-style file with coordinates for d6gf3a2.
(The format of our PDB-style files is described here.)

Timeline for d6gf3a2: