![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
![]() | Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
![]() | Protein automated matches [227071] (7 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [226565] (136 PDB entries) |
![]() | Domain d6gf3b2: 6gf3 B:246-438 [368531] Other proteins in same PDB: d6gf3a1, d6gf3b1, d6gf3c1, d6gf3d1, d6gf3e_, d6gf3f1 automated match to d3rycd2 complexed with acp, ca, edo, ex5, gdp, gtp, mes, mg |
PDB Entry: 6gf3 (more details), 2.4 Å
SCOPe Domain Sequences for d6gf3b2:
Sequence, based on SEQRES records: (download)
>d6gf3b2 d.79.2.1 (B:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]} gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq qyqda
>d6gf3b2 d.79.2.1 (B:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]} gqlnadlrklavnmvpfprlhffmpgfaplqyraltvpeltqqmfdsknmmaacdprhgr yltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfig nstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqda
Timeline for d6gf3b2: