Lineage for d6gf3f1 (6gf3 F:1-76)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2444095Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2444096Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2444379Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein)
  6. 2444380Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species)
  7. 2444381Species Chicken (Gallus gallus) [TaxId:9031] [311384] (84 PDB entries)
  8. 3068464Domain d6gf3f1: 6gf3 F:1-76 [368526]
    Other proteins in same PDB: d6gf3a1, d6gf3a2, d6gf3b1, d6gf3b2, d6gf3c1, d6gf3c2, d6gf3d1, d6gf3d2, d6gf3e_
    automated match to d3tiia1
    complexed with acp, ca, edo, ex5, gdp, gtp, mes, mg

Details for d6gf3f1

PDB Entry: 6gf3 (more details), 2.4 Å

PDB Description: tubulin-jerantinine b acetate complex
PDB Compounds: (F:) tubulin tyrosine ligase

SCOPe Domain Sequences for d6gf3f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gf3f1 c.30.1.9 (F:1-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

SCOPe Domain Coordinates for d6gf3f1:

Click to download the PDB-style file with coordinates for d6gf3f1.
(The format of our PDB-style files is described here.)

Timeline for d6gf3f1:

  • d6gf3f1 appears in periodic updates to SCOPe 2.07 starting on 2019-05-09