Lineage for d5zrmc_ (5zrm C:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)
  6. Protein automated matches [190196] (7 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [186938] (20 PDB entries)
  8. Domain d5zrmc_: 5zrm C: [368489]
    automated match to d1yjxe_
    complexed with 9hu, cl, mes

Details for d5zrmc_

PDB Entry: 5zrm (more details), 2.2800000000000002 Å

PDB Description: phosphoglycerate mutase 1 complexed with a small molecule inhibitor in-ac
PDB Compounds: (C:) phosphoglycerate mutase 1

SCOPe Domain Sequences for d5zrmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zrmc_ c.60.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aayklvlirhgesawnlenrfsgwydadlspagheeakrggqalrdagyefdicftsvqk
rairtlwtvldaidqmwlpvvrtwrlnerhyggltglnkaetaakhgeaqvkiwrrsydv
ppppmepdhpfysniskdrryadltedqlpsceslkdtiaralpfwneeivpqikegkrv
liaahgnslrgivkhleglseeaimelnlptgipivyeldknlkpikpmqflgd

SCOPe Domain Coordinates for d5zrmc_ are not available.

Timeline for d5zrmc_:

Domains from other chains:
(mouse over for more information)
d5zrmb_