Lineage for d1yjxe_ (1yjx E:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)
  6. Protein automated matches [190196] (7 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [186938] (20 PDB entries)
  8. Domain d1yjxe_: 1yjx E: [162223]
    automated match to d1e58a_
    complexed with cit, cl

Details for d1yjxe_

PDB Entry: 1yjx (more details), 2.8 Å

PDB Description: Crystal structure of human B type phosphoglycerate mutase
PDB Compounds: (E:) phosphoglycerate mutase 1

SCOPe Domain Sequences for d1yjxe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yjxe_ c.60.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aayklvlirhgesawnlenrfsgwydadlspagheeakrggqalrdagyefdicftsvqk
rairtlwtvldaidqmwlpvvrtwrlnerhyggltglnkaetaakhgeaqvkiwrrsydv
ppppmepdhpfysniskdrryadltedqlpsceslkdtiaralpfwneeivpqikegkrv
liaahgnslrgivkhleglseeaimelnlptgipivyeldknlkpikpmqflgdeetvrk
ame

SCOPe Domain Coordinates for d1yjxe_ are not available.

Timeline for d1yjxe_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1yjxa_, d1yjxb_, d1yjxc_, d1yjxd_, d1yjxf_, d1yjxg_, d1yjxh_, d1yjxi_, d1yjxj_, d1yjxk_, d1yjxl_