PDB entry 5zrm

View 5zrm on RCSB PDB site
Description: Phosphoglycerate mutase 1 complexed with a small molecule inhibitor In-AC
Class: isomerase/inhibitor
Keywords: Phosphoglycerate mutase 1, ISOMERASE-INHIBITOR complex
Deposited on 2018-04-24, released 2019-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-01, with a file datestamp of 2019-04-26.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: phosphoglycerate mutase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PGAM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zrmb_
  • Chain 'C':
    Compound: phosphoglycerate mutase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PGAM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zrmc_
  • Heterogens: 9HU, CL, MES, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zrmB (B:)
    aayklvlirhgesawnlenrfsgwydadlspagheeakrggqalrdagyefdicftsvqk
    rairtlwtvldaidqmwlpvvrtwrlnerhyggltglnkaetaakhgeaqvkiwrrsydv
    ppppmepdhpfysniskdrryadltedqlpsceslkdtiaralpfwneeivpqikegkrv
    liaahgnslrgivkhleglseeaimelnlptgipivyeldknlkpikpmqflgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zrmB (B:)
    ayklvlirhgesawnlenrfsgwydadlspagheeakrggqalrdagyefdicftsvqkr
    airtlwtvldaidqmwlpvvrtwrlnerhyggltglnkaetaakhgeaqvkiwrrsydvp
    pppmepdhpfysniskdrryadltedqlpsceslkdtiaralpfwneeivpqikegkrvl
    iaahgnslrgivkhleglseeaimelnlptgipivyeldknlkpikpmqflgd
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zrmC (C:)
    aayklvlirhgesawnlenrfsgwydadlspagheeakrggqalrdagyefdicftsvqk
    rairtlwtvldaidqmwlpvvrtwrlnerhyggltglnkaetaakhgeaqvkiwrrsydv
    ppppmepdhpfysniskdrryadltedqlpsceslkdtiaralpfwneeivpqikegkrv
    liaahgnslrgivkhleglseeaimelnlptgipivyeldknlkpikpmqflgd