Lineage for d6d8ha_ (6d8h A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635214Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 2635336Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins)
  6. 2635463Protein automated matches [197331] (11 species)
    not a true protein
  7. 2635502Species Mesobuthus tamulus [TaxId:34647] [255376] (18 PDB entries)
  8. 2635505Domain d6d8ha_: 6d8h A: [368352]
    automated match to d2lu9a_
    mutant

Details for d6d8ha_

PDB Entry: 6d8h (more details)

PDB Description: nmr solution structure of tamapin, mutant y31+n
PDB Compounds: (A:) Potassium channel toxin alpha-KTx 5.4

SCOPe Domain Sequences for d6d8ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d8ha_ g.3.7.2 (A:) automated matches {Mesobuthus tamulus [TaxId: 34647]}
afcnlrrcelscrslgllgkcigeeckcvpyn

SCOPe Domain Coordinates for d6d8ha_:

Click to download the PDB-style file with coordinates for d6d8ha_.
(The format of our PDB-style files is described here.)

Timeline for d6d8ha_: