PDB entry 6d8h

View 6d8h on RCSB PDB site
Description: NMR solution structure of tamapin, mutant Y31+N
Class: toxin
Keywords: Tamapin mutant, Y31+N, CSalpha/beta, SK channels, TOXIN
Deposited on 2018-04-26, released 2019-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-01, with a file datestamp of 2019-04-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Potassium channel toxin alpha-KTx 5.4
  Species: Mesobuthus tamulus [TaxId:34647]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P59869 (0-30)
    • insertion (31)
  Domains in SCOPe 2.07: d6d8ha_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6d8hA (A:)
  afcnlrrcelscrslgllgkcigeeckcvpyn