Lineage for d6dyha_ (6dyh A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311272Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2311322Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 2311323Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
    automatically mapped to Pfam PF07361
  6. 2311453Protein automated matches [190502] (2 species)
    not a true protein
  7. Species Escherichia coli [TaxId:562] [187450] (24 PDB entries)
  8. 3067968Domain d6dyha_: 6dyh A: [368030]
    automated match to d2bc5a_
    complexed with hec, v

Details for d6dyha_

PDB Entry: 6dyh (more details), 1.83 Å

PDB Description: vanadyl-bound structure of the engineered cyt cb562 variant, ch3y
PDB Compounds: (A:) Soluble cytochrome b562

SCOPe Domain Sequences for d6dyha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dyha_ a.24.3.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemwd
frhgfdhlvyhiddalklanegkvkeaqaaaeqlkchcnachqkyr

SCOPe Domain Coordinates for d6dyha_:

Click to download the PDB-style file with coordinates for d6dyha_.
(The format of our PDB-style files is described here.)

Timeline for d6dyha_:

  • d6dyha_ is new in SCOPe 2.07-stable