SCOPe 2.07: Domain d6dyca_: 6dyc A:

Lineage for d6dyca_ (6dyc A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.3: Cytochromes [47175] (3 families)
   Heme-containing proteins

5. Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
   automatically mapped to Pfam PF07361

6. Protein automated matches [190502] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187450] (24 PDB entries)

8. Domain d6dyca_: 6dyc A: [368007]
   automated match to d2bc5a_
   complexed with ca, co, hec

Details for d6dyca_

PDB Entry: 6dyc, 1.33 Å

PDB Description: co(ii)-bound structure of the engineered cyt cb562 variant, ch3

PDB Compounds: (A:) Soluble cytochrome b562

SCOPe Domain Sequences for d6dyca_:

Sequence; same for both SEQRES and ATOM records:

>d6dyca_ a.24.3.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemwd
frhgfdhlvghiddalklanegkvkeaqaaaeqlkchcnachqkyr

Timeline for d6dyca_:

• d6dyca_ is new in SCOPe 2.07-stable
  
• d6dyca_ appears in the current release, SCOPe 2.08