Lineage for d6r3pb_ (6r3p B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2477556Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2477974Protein Meiotic recombination protein DMC1/LIM15 homolog [110556] (1 species)
  7. 2477975Species Human (Homo sapiens) [TaxId:9606] [110557] (2 PDB entries)
    Uniprot Q14565
  8. 2477977Domain d6r3pb_: 6r3p B: [367234]
    Other proteins in same PDB: d6r3pa2, d6r3pc2, d6r3pd2
    automated match to d1v5wa_
    complexed with 1pe, edo, p6g, peg, pg4

Details for d6r3pb_

PDB Entry: 6r3p (more details), 2.05 Å

PDB Description: crystal structure of human dmc1 atpase domain
PDB Compounds: (B:) Meiotic recombination protein DMC1/LIM15 homolog

SCOPe Domain Sequences for d6r3pb_:

Sequence, based on SEQRES records: (download)

>d6r3pb_ c.37.1.11 (B:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]}
pgfltafeysekrkmvfhittgsqefdkllgggiesmaiteafgefrtgktqlshtlcvt
aqlpgaggypggkiifidtentfrpdrlrdiadrfnvdhdavldnvlyaraytsehqmel
ldyvaakfheeagifklliidsimalfrvdfsgrgelaerqqklaqmlsrlqkiseeynv
avfvtnqmtadpgatmtfqadpkkpigghilahasttrislrkgrgelriakiydspemp
eneatfaitaggigdake

Sequence, based on observed residues (ATOM records): (download)

>d6r3pb_ c.37.1.11 (B:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]}
pgfltafeysekrkmvfhittgsqefdkllgggiesmaiteafgefrtgktqlshtlcvt
aqlpgaggypggkiifidtentfrpdrlrdiadrfnvdhdavldnvlyaraytsehqmel
ldyvaakfheeagifklliidsimalfrvdfsgrgelaerqqklaqmlsrlqkiseeynv
avfvtnqmtakkpigghilahasttrislrkgrgelriakiydspempeneatfaitagg
igdake

SCOPe Domain Coordinates for d6r3pb_:

Click to download the PDB-style file with coordinates for d6r3pb_.
(The format of our PDB-style files is described here.)

Timeline for d6r3pb_: