Lineage for d6hc9b_ (6hc9 B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. Protein Glutamate receptor ligand binding core [53881] (5 species)
  7. Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (157 PDB entries)
  8. Domain d6hc9b_: 6hc9 B: [367102]
    Other proteins in same PDB: d6hc9a2
    automated match to d4h8ja_
    complexed with cl, fxw, glu, gol, peg, pge, so4

Details for d6hc9b_

PDB Entry: 6hc9 (more details), 2.4 Å

PDB Description: structure of glua2 ligand-binding domain (s1s2j-l504y-n775s) in complex with glutamate and tdpam02 at 2.4 a resolution.
PDB Compounds: (B:) Glutamate receptor 2,

SCOPe Domain Sequences for d6hc9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hc9b_ c.94.1.1 (B:) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltityvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklse
qglldklknkwwydkgec

SCOPe Domain Coordinates for d6hc9b_ are not available.

Timeline for d6hc9b_:

Domains from other chains:
(mouse over for more information)
d6hc9a1, d6hc9a2