Lineage for d4h8ja_ (4h8j A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. Protein Glutamate receptor ligand binding core [53881] (5 species)
  7. Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (157 PDB entries)
  8. Domain d4h8ja_: 4h8j A: [336985]
    automated match to d5ftia_
    complexed with edo, mes, so4

Details for d4h8ja_

PDB Entry: 4h8j (more details), 1.8 Å

PDB Description: structure of glua2-lbd in complex with mes
PDB Compounds: (A:) Glutamate receptor 2

SCOPe Domain Sequences for d4h8ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h8ja_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne
qglldklknkwwydkgecgsg

SCOPe Domain Coordinates for d4h8ja_ are not available.

Timeline for d4h8ja_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4h8jb_, d4h8jc_, d4h8jd_