PDB entry 6hc9

View 6hc9 on RCSB PDB site
Description: structure of glua2 ligand-binding domain (s1s2j-l504y-n775s) in complex with glutamate and tdpam02 at 2.4 a resolution.
Class: membrane protein
Keywords: ampa receptor, gluA2, ligand-binding domain, glua2-S1S2J-L504Y-N775S, membrane protein, signaling protein, positive allosteric modulator
Deposited on 2018-08-14, released 2019-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-03, with a file datestamp of 2019-03-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate receptor 2,
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19491 (2-116)
      • expression tag (0-1)
      • engineered mutation (93)
      • linker (117-118)
    • Uniprot P19491 (119-263)
      • engineered mutation (241)
    Domains in SCOPe 2.07: d6hc9a1, d6hc9a2
  • Chain 'B':
    Compound: Glutamate receptor 2,
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19491 (Start-116)
      • engineered mutation (93)
      • linker (117-118)
    • Uniprot P19491 (119-End)
      • engineered mutation (241)
    Domains in SCOPe 2.07: d6hc9b_
  • Heterogens: FXW, GOL, CL, GLU, SO4, PEG, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hc9A (A:)
    ganktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgk
    ygardadtkiwngmvgelvygkadiaiapltityvreevidfskpfmslgisimikkgtp
    iesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvar
    vrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlk
    lseqglldklknkwwydkgecgsg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6hc9B (B:)
    ganktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgk
    ygardadtkiwngmvgelvygkadiaiapltityvreevidfskpfmslgisimikkgtp
    iesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvar
    vrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlk
    lseqglldklknkwwydkgecgsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hc9B (B:)
    ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
    rdadtkiwngmvgelvygkadiaiapltityvreevidfskpfmslgisimikkgtpies
    aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
    skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklse
    qglldklknkwwydkgec