Lineage for d6jc5f_ (6jc5 F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2939774Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2940226Protein automated matches [190406] (19 species)
    not a true protein
  7. 2940602Species Stichodactyla haddoni [TaxId:475174] [366510] (2 PDB entries)
  8. 2940616Domain d6jc5f_: 6jc5 F: [366558]
    Other proteins in same PDB: d6jc5a2, d6jc5b2, d6jc5c2, d6jc5d2, d6jc5g2
    automated match to d1yzwa_
    complexed with bjf

Details for d6jc5f_

PDB Entry: 6jc5 (more details), 2.05 Å

PDB Description: crystal structure of the blue fluorescent protein with a leu-leu-gly tri-peptide chromophore derived from the purple chromoprotein of stichodactyla haddoni
PDB Compounds: (F:) shBFP

SCOPe Domain Sequences for d6jc5f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jc5f_ d.22.1.1 (F:) automated matches {Stichodactyla haddoni [TaxId: 475174]}
llkesmrikmdmegtvnghyfkcegegdgnpftgtqsmrihvtegaplpfafdilapccx
srtfihhtagipdffkqsfpegftwertttyedggiltahqdtslegncliykvkvlgtn
fpadgpvmknksegwepctevvypdngvlcgrnvmalkvgdrrlichlyssykskkaira
ltmpgfhftdirlqmprkkkdeyfelyeasvarysdlpek

SCOPe Domain Coordinates for d6jc5f_:

Click to download the PDB-style file with coordinates for d6jc5f_.
(The format of our PDB-style files is described here.)

Timeline for d6jc5f_: