![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
![]() | Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
![]() | Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
![]() | Protein automated matches [190406] (19 species) not a true protein |
![]() | Species Stichodactyla haddoni [TaxId:475174] [366510] (2 PDB entries) |
![]() | Domain d6jc5f_: 6jc5 F: [366558] Other proteins in same PDB: d6jc5a2, d6jc5b2, d6jc5c2, d6jc5d2, d6jc5g2 automated match to d1yzwa_ complexed with bjf |
PDB Entry: 6jc5 (more details), 2.05 Å
SCOPe Domain Sequences for d6jc5f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jc5f_ d.22.1.1 (F:) automated matches {Stichodactyla haddoni [TaxId: 475174]} llkesmrikmdmegtvnghyfkcegegdgnpftgtqsmrihvtegaplpfafdilapccx srtfihhtagipdffkqsfpegftwertttyedggiltahqdtslegncliykvkvlgtn fpadgpvmknksegwepctevvypdngvlcgrnvmalkvgdrrlichlyssykskkaira ltmpgfhftdirlqmprkkkdeyfelyeasvarysdlpek
Timeline for d6jc5f_: