SCOPe 2.08: Domain d6jc5b1: 6jc5 B:4-225

Lineage for d6jc5b1 (6jc5 B:4-225)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (19 species)
   not a true protein

7. Species Stichodactyla haddoni [TaxId:475174] [366510] (2 PDB entries)

8. Domain d6jc5b1: 6jc5 B:4-225 [366516]
   Other proteins in same PDB: d6jc5a2, d6jc5b2, d6jc5c2, d6jc5d2, d6jc5g2
   automated match to d1yzwa_
   complexed with bjf

Details for d6jc5b1

PDB Entry: 6jc5, 2.05 Å

PDB Description: crystal structure of the blue fluorescent protein with a leu-leu-gly tri-peptide chromophore derived from the purple chromoprotein of stichodactyla haddoni

PDB Compounds: (B:) shBFP

SCOPe Domain Sequences for d6jc5b1:

Sequence; same for both SEQRES and ATOM records:

>d6jc5b1 d.22.1.1 (B:4-225) automated matches {Stichodactyla haddoni [TaxId: 475174]}
llkesmrikmdmegtvnghyfkcegegdgnpftgtqsmrihvtegaplpfafdilapccx
srtfihhtagipdffkqsfpegftwertttyedggiltahqdtslegncliykvkvlgtn
fpadgpvmknksegwepctevvypdngvlcgrnvmalkvgdrrlichlyssykskkaira
ltmpgfhftdirlqmprkkkdeyfelyeasvarysdlpek

Timeline for d6jc5b1:

• d6jc5b1 first appeared in SCOPe 2.07