PDB entry 6jc5

View 6jc5 on RCSB PDB site
Description: Crystal structure of the blue fluorescent protein with a Leu-Leu-Gly tri-peptide chromophore derived from the purple chromoprotein of Stichodactyla haddoni
Class: fluorescent protein
Keywords: Sea anemone, Green fluorescent protein, UV absorption, emission spectra, biomarker, FLUORESCENT PROTEIN
Deposited on 2019-01-28, released 2019-03-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-03-20, with a file datestamp of 2019-03-15.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: shBFP
    Species: Stichodactyla haddoni [TaxId:475174]
    Database cross-references and differences (RAF-indexed):
    • PDB 6JC5 (Start-227)
    Domains in SCOPe 2.08: d6jc5a1, d6jc5a2
  • Chain 'B':
    Compound: shBFP
    Species: Stichodactyla haddoni [TaxId:475174]
    Database cross-references and differences (RAF-indexed):
    • PDB 6JC5 (Start-227)
    Domains in SCOPe 2.08: d6jc5b1, d6jc5b2
  • Chain 'C':
    Compound: shBFP
    Species: Stichodactyla haddoni [TaxId:475174]
    Database cross-references and differences (RAF-indexed):
    • PDB 6JC5 (Start-227)
    Domains in SCOPe 2.08: d6jc5c1, d6jc5c2
  • Chain 'D':
    Compound: shBFP
    Species: Stichodactyla haddoni [TaxId:475174]
    Database cross-references and differences (RAF-indexed):
    • PDB 6JC5 (Start-227)
    Domains in SCOPe 2.08: d6jc5d1, d6jc5d2
  • Chain 'E':
    Compound: shBFP
    Species: Stichodactyla haddoni [TaxId:475174]
    Database cross-references and differences (RAF-indexed):
    • PDB 6JC5 (Start-227)
    Domains in SCOPe 2.08: d6jc5e_
  • Chain 'F':
    Compound: shBFP
    Species: Stichodactyla haddoni [TaxId:475174]
    Database cross-references and differences (RAF-indexed):
    • PDB 6JC5 (Start-227)
    Domains in SCOPe 2.08: d6jc5f_
  • Chain 'G':
    Compound: shBFP
    Species: Stichodactyla haddoni [TaxId:475174]
    Database cross-references and differences (RAF-indexed):
    • PDB 6JC5 (Start-227)
    Domains in SCOPe 2.08: d6jc5g1, d6jc5g2
  • Chain 'H':
    Compound: shBFP
    Species: Stichodactyla haddoni [TaxId:475174]
    Database cross-references and differences (RAF-indexed):
    • PDB 6JC5 (Start-227)
    Domains in SCOPe 2.08: d6jc5h_
  • Heterogens: BJF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6jc5A (A:)
    mhhhhhhgllkesmrikmdmegtvnghyfkcegegdgnpftgtqsmrihvtegaplpfaf
    dilapccxsrtfihhtagipdffkqsfpegftwertttyedggiltahqdtslegncliy
    kvkvlgtnfpadgpvmknksegwepctevvypdngvlcgrnvmalkvgdrrlichlyssy
    kskkairaltmpgfhftdirlqmprkkkdeyfelyeasvarysdlpek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jc5A (A:)
    gllkesmrikmdmegtvnghyfkcegegdgnpftgtqsmrihvtegaplpfafdilapcc
    xsrtfihhtagipdffkqsfpegftwertttyedggiltahqdtslegncliykvkvlgt
    nfpadgpvmknksegwepctevvypdngvlcgrnvmalkvgdrrlichlyssykskkair
    altmpgfhftdirlqmprkkkdeyfelyeasvarysdlpek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6jc5B (B:)
    mhhhhhhgllkesmrikmdmegtvnghyfkcegegdgnpftgtqsmrihvtegaplpfaf
    dilapccxsrtfihhtagipdffkqsfpegftwertttyedggiltahqdtslegncliy
    kvkvlgtnfpadgpvmknksegwepctevvypdngvlcgrnvmalkvgdrrlichlyssy
    kskkairaltmpgfhftdirlqmprkkkdeyfelyeasvarysdlpek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jc5B (B:)
    gllkesmrikmdmegtvnghyfkcegegdgnpftgtqsmrihvtegaplpfafdilapcc
    xsrtfihhtagipdffkqsfpegftwertttyedggiltahqdtslegncliykvkvlgt
    nfpadgpvmknksegwepctevvypdngvlcgrnvmalkvgdrrlichlyssykskkair
    altmpgfhftdirlqmprkkkdeyfelyeasvarysdlpek
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6jc5C (C:)
    mhhhhhhgllkesmrikmdmegtvnghyfkcegegdgnpftgtqsmrihvtegaplpfaf
    dilapccxsrtfihhtagipdffkqsfpegftwertttyedggiltahqdtslegncliy
    kvkvlgtnfpadgpvmknksegwepctevvypdngvlcgrnvmalkvgdrrlichlyssy
    kskkairaltmpgfhftdirlqmprkkkdeyfelyeasvarysdlpek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jc5C (C:)
    gllkesmrikmdmegtvnghyfkcegegdgnpftgtqsmrihvtegaplpfafdilapcc
    xsrtfihhtagipdffkqsfpegftwertttyedggiltahqdtslegncliykvkvlgt
    nfpadgpvmknksegwepctevvypdngvlcgrnvmalkvgdrrlichlyssykskkair
    altmpgfhftdirlqmprkkkdeyfelyeasvarysdlpek
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6jc5D (D:)
    mhhhhhhgllkesmrikmdmegtvnghyfkcegegdgnpftgtqsmrihvtegaplpfaf
    dilapccxsrtfihhtagipdffkqsfpegftwertttyedggiltahqdtslegncliy
    kvkvlgtnfpadgpvmknksegwepctevvypdngvlcgrnvmalkvgdrrlichlyssy
    kskkairaltmpgfhftdirlqmprkkkdeyfelyeasvarysdlpek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jc5D (D:)
    gllkesmrikmdmegtvnghyfkcegegdgnpftgtqsmrihvtegaplpfafdilapcc
    xsrtfihhtagipdffkqsfpegftwertttyedggiltahqdtslegncliykvkvlgt
    nfpadgpvmknksegwepctevvypdngvlcgrnvmalkvgdrrlichlyssykskkair
    altmpgfhftdirlqmprkkkdeyfelyeasvarysdlpek
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6jc5E (E:)
    mhhhhhhgllkesmrikmdmegtvnghyfkcegegdgnpftgtqsmrihvtegaplpfaf
    dilapccxsrtfihhtagipdffkqsfpegftwertttyedggiltahqdtslegncliy
    kvkvlgtnfpadgpvmknksegwepctevvypdngvlcgrnvmalkvgdrrlichlyssy
    kskkairaltmpgfhftdirlqmprkkkdeyfelyeasvarysdlpek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jc5E (E:)
    llkesmrikmdmegtvnghyfkcegegdgnpftgtqsmrihvtegaplpfafdilapccx
    srtfihhtagipdffkqsfpegftwertttyedggiltahqdtslegncliykvkvlgtn
    fpadgpvmknksegwepctevvypdngvlcgrnvmalkvgdrrlichlyssykskkaira
    ltmpgfhftdirlqmprkkkdeyfelyeasvarysdlpek
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6jc5F (F:)
    mhhhhhhgllkesmrikmdmegtvnghyfkcegegdgnpftgtqsmrihvtegaplpfaf
    dilapccxsrtfihhtagipdffkqsfpegftwertttyedggiltahqdtslegncliy
    kvkvlgtnfpadgpvmknksegwepctevvypdngvlcgrnvmalkvgdrrlichlyssy
    kskkairaltmpgfhftdirlqmprkkkdeyfelyeasvarysdlpek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jc5F (F:)
    llkesmrikmdmegtvnghyfkcegegdgnpftgtqsmrihvtegaplpfafdilapccx
    srtfihhtagipdffkqsfpegftwertttyedggiltahqdtslegncliykvkvlgtn
    fpadgpvmknksegwepctevvypdngvlcgrnvmalkvgdrrlichlyssykskkaira
    ltmpgfhftdirlqmprkkkdeyfelyeasvarysdlpek
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6jc5G (G:)
    mhhhhhhgllkesmrikmdmegtvnghyfkcegegdgnpftgtqsmrihvtegaplpfaf
    dilapccxsrtfihhtagipdffkqsfpegftwertttyedggiltahqdtslegncliy
    kvkvlgtnfpadgpvmknksegwepctevvypdngvlcgrnvmalkvgdrrlichlyssy
    kskkairaltmpgfhftdirlqmprkkkdeyfelyeasvarysdlpek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jc5G (G:)
    gllkesmrikmdmegtvnghyfkcegegdgnpftgtqsmrihvtegaplpfafdilapcc
    xsrtfihhtagipdffkqsfpegftwertttyedggiltahqdtslegncliykvkvlgt
    nfpadgpvmknksegwepctevvypdngvlcgrnvmalkvgdrrlichlyssykskkair
    altmpgfhftdirlqmprkkkdeyfelyeasvarysdlpek
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6jc5H (H:)
    mhhhhhhgllkesmrikmdmegtvnghyfkcegegdgnpftgtqsmrihvtegaplpfaf
    dilapccxsrtfihhtagipdffkqsfpegftwertttyedggiltahqdtslegncliy
    kvkvlgtnfpadgpvmknksegwepctevvypdngvlcgrnvmalkvgdrrlichlyssy
    kskkairaltmpgfhftdirlqmprkkkdeyfelyeasvarysdlpek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jc5H (H:)
    llkesmrikmdmegtvnghyfkcegegdgnpftgtqsmrihvtegaplpfafdilapccx
    srtfihhtagipdffkqsfpegftwertttyedggiltahqdtslegncliykvkvlgtn
    fpadgpvmknksegwepctevvypdngvlcgrnvmalkvgdrrlichlyssykskkaira
    ltmpgfhftdirlqmprkkkdeyfelyeasvarysdlpek