Lineage for d6fvka_ (6fvk A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2833366Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2833482Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins)
    automatically mapped to Pfam PF02126
  6. 2833483Protein Phosphotriesterase (parathion hydrolase, PTE) [51565] (5 species)
  7. 2833520Species Pseudomonas diminuta [TaxId:293] [51566] (41 PDB entries)
    Uniprot P0A434 30-365
  8. 2833566Domain d6fvka_: 6fvk A: [366475]
    automated match to d1jgmb_
    complexed with e8n, e8w, fmt, gol, so4, zn

Details for d6fvka_

PDB Entry: 6fvk (more details), 1.77 Å

PDB Description: phosphotriesterase pte_c23_3
PDB Compounds: (A:) Parathion hydrolase

SCOPe Domain Sequences for d6fvka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fvka_ c.1.9.3 (A:) Phosphotriesterase (parathion hydrolase, PTE) {Pseudomonas diminuta [TaxId: 293]}
drintvrgpitiseagftlthehicgssagflrawpeffgsraalvekavrglrraraag
vrtivdvstfdigrdvsllaevsraadvhivaatglwedpplsmrlrsveeltqfflrei
qygiedtgiragiikvatngkatpfqelvlraaaraslatgvpvtthtaasqrdgeqqaa
ifeseglspsrvcighsddtddlsyltalaargyligldgiphsaiglednasasallgn
rswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdsvnpdgmafiplrvip
flrekgvsqetlagitvtnparflsptlra

SCOPe Domain Coordinates for d6fvka_:

Click to download the PDB-style file with coordinates for d6fvka_.
(The format of our PDB-style files is described here.)

Timeline for d6fvka_: