Lineage for d1bb6__ (1bb6 -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 28759Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 28760Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 28769Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 28802Protein Lysozyme [53961] (13 species)
  7. 29145Species Rainbow trout (Oncorhynchus mykiss) [TaxId:8022] [53973] (7 PDB entries)
  8. 29152Domain d1bb6__: 1bb6 - [36594]

Details for d1bb6__

PDB Entry: 1bb6 (more details), 2 Å

PDB Description: lysozyme complex with 4-methyl-umbelliferyl chitotriose

SCOP Domain Sequences for d1bb6__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bb6__ d.2.1.2 (-) Lysozyme {Rainbow trout (Oncorhynchus mykiss)}
kvydrcelaralkasgmdgyagnslpnwvclskwessyntqatnrntdgstdygifqins
rywcddgrtpgaknvcgircsqlltddltvaircakrvvldpngigawvawrlhcqnqdl
rsyvagcgv

SCOP Domain Coordinates for d1bb6__:

Click to download the PDB-style file with coordinates for d1bb6__.
(The format of our PDB-style files is described here.)

Timeline for d1bb6__: