SCOPe 2.08: Domain d6agtc1: 6agt C:79-223

Lineage for d6agtc1 (6agt C:79-223)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (52 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:5843] [354073] (9 PDB entries)

8. Domain d6agtc1: 6agt C:79-223 [365793]
   Other proteins in same PDB: d6agta2, d6agtb2, d6agtc2, d6agtd2
   automated match to d3bjua1
   complexed with 9x0, co, fmt, lys, mla

Details for d6agtc1

PDB Entry: 6agt, 1.95 Å

PDB Description: crystal structure of pfkrs complexed with chromone inhibitor

PDB Compounds: (C:) Lysine--tRNA ligase

SCOPe Domain Sequences for d6agtc1:

Sequence; same for both SEQRES and ATOM records:

>d6agtc1 b.40.4.0 (C:79-223) automated matches {Plasmodium falciparum [TaxId: 5843]}
dprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitgr
imrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpgk
skkgelsifpketillsaclhmlpm

Timeline for d6agtc1:

• d6agtc1 first appeared in SCOPe 2.07