PDB entry 6agt

View 6agt on RCSB PDB site
Description: Crystal structure of PfKRS complexed with chromone inhibitor
Class: ligase/inhibitor
Keywords: krs, chromone inhibitor, aminoacylation, ATP binding protein, ligase-inhibitor complex
Deposited on 2018-08-14, released 2019-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysine--tRNA ligase
    Species: Plasmodium falciparum [TaxId:5843]
    Gene: PFNF54_04763
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6agta1, d6agta2
  • Chain 'B':
    Compound: Lysine--tRNA ligase
    Species: Plasmodium falciparum [TaxId:5843]
    Gene: PFNF54_04763
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6agtb1, d6agtb2
  • Chain 'C':
    Compound: Lysine--tRNA ligase
    Species: Plasmodium falciparum [TaxId:5843]
    Gene: PFNF54_04763
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6agtc1, d6agtc2
  • Chain 'D':
    Compound: Lysine--tRNA ligase
    Species: Plasmodium falciparum [TaxId:5843]
    Gene: PFNF54_04763
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6agtd1, d6agtd2
  • Heterogens: 9X0, CO, FMT, MLA, LYS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6agtA (A:)
    evdprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnit
    grimrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfp
    gkskkgelsifpketillsaclhmlpmkyglkdteiryrqryldllinessrhtfvtrtk
    iinflrnflnergffevetpmmnliagganarpfithhndldldlylriatelplkmliv
    ggidkvyeigkvfrnegidnthnpeftscefywayadyndlikwsedffsqlvyhlfgty
    kisynkdgpenqpieidftppypkvsiveeiekvtntileqpfdsnetiekminiikehk
    ielpnpptaaklldqlashfienkyndkpffivehpqimsplakyhrtkpglterlemfi
    cgkevlnaytelndpfkqkecfklqqkdrekgdteaaqldsafctsleyglpptgglglg
    idritmfltnknsikdvilfptmrpan
    

    Sequence, based on observed residues (ATOM records): (download)
    >6agtA (A:)
    dprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitgr
    imrvsqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpgkskk
    gelsifpketillsaclhmlpmteiryrqryldllinessrhtfvtrtkiinflrnflne
    rgffevetpmmnliagganarpfithhndldldlylriatelplkmlivggidkvyeigk
    vfrnegidnthnpeftscefywayadyndlikwsedffsqlvyhlfgtykisynkdgpen
    qpieidftppypkvsiveeiekvtntileqpfdsnetiekminiikehkielpnpptaak
    lldqlashfienkyndkpffivehpqimsplakyhrtkpglterlemficgkevlnayte
    lndpfkqkecfklqqkdrekgdteaaqldsafctsleyglpptgglglgidritmfltnk
    nsikdvilfptmrpa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6agtB (B:)
    evdprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnit
    grimrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfp
    gkskkgelsifpketillsaclhmlpmkyglkdteiryrqryldllinessrhtfvtrtk
    iinflrnflnergffevetpmmnliagganarpfithhndldldlylriatelplkmliv
    ggidkvyeigkvfrnegidnthnpeftscefywayadyndlikwsedffsqlvyhlfgty
    kisynkdgpenqpieidftppypkvsiveeiekvtntileqpfdsnetiekminiikehk
    ielpnpptaaklldqlashfienkyndkpffivehpqimsplakyhrtkpglterlemfi
    cgkevlnaytelndpfkqkecfklqqkdrekgdteaaqldsafctsleyglpptgglglg
    idritmfltnknsikdvilfptmrpan
    

    Sequence, based on observed residues (ATOM records): (download)
    >6agtB (B:)
    vdprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitg
    rimrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpg
    kskkgelsifpketillsaclhmlpmkyglkdteiryrqryldllinessrhtfvtrtki
    inflrnflnergffevetpmmnliagganarpfithhndldldlylriatelplkmlivg
    gidkvyeigkvfrnegidnthnpeftscefywayadyndlikwsedffsqlvyhlfgtyk
    isynkdgpenqpieidftppypkvsiveeiekvtntileqpfdsnetiekminiikehki
    elpnpptaaklldqlashfienkyndkpffivehpqimsplakyhrtkpglterlemfic
    gkevlnaytelndpfkqkecfklqqkdrekgdteaaqldsafctsleyglpptgglglgi
    dritmfltnknsikdvilfptmrpan
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6agtC (C:)
    evdprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnit
    grimrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfp
    gkskkgelsifpketillsaclhmlpmkyglkdteiryrqryldllinessrhtfvtrtk
    iinflrnflnergffevetpmmnliagganarpfithhndldldlylriatelplkmliv
    ggidkvyeigkvfrnegidnthnpeftscefywayadyndlikwsedffsqlvyhlfgty
    kisynkdgpenqpieidftppypkvsiveeiekvtntileqpfdsnetiekminiikehk
    ielpnpptaaklldqlashfienkyndkpffivehpqimsplakyhrtkpglterlemfi
    cgkevlnaytelndpfkqkecfklqqkdrekgdteaaqldsafctsleyglpptgglglg
    idritmfltnknsikdvilfptmrpan
    

    Sequence, based on observed residues (ATOM records): (download)
    >6agtC (C:)
    dprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitgr
    imrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpgk
    skkgelsifpketillsaclhmlpmteiryrqryldllinessrhtfvtrtkiinflrnf
    lnergffevetpmmnliagganarpfithhndldldlylriatelplkmlivggidkvye
    igkvfrnegidnthnpeftscefywayadyndlikwsedffsqlvyhlfgtykisynkdg
    penqpieidftppypkvsiveeiekvtntileqpfdsnetiekminiikehkielpnppt
    aaklldqlashfienkyndkpffivehpqimsplakyhrtkpglterlemficgkevlna
    ytelndpfkqkecfklqqkdrekgdteaaqldsafctsleyglpptgglglgidritmfl
    tnknsikdvilfptmrpan
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6agtD (D:)
    evdprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnit
    grimrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfp
    gkskkgelsifpketillsaclhmlpmkyglkdteiryrqryldllinessrhtfvtrtk
    iinflrnflnergffevetpmmnliagganarpfithhndldldlylriatelplkmliv
    ggidkvyeigkvfrnegidnthnpeftscefywayadyndlikwsedffsqlvyhlfgty
    kisynkdgpenqpieidftppypkvsiveeiekvtntileqpfdsnetiekminiikehk
    ielpnpptaaklldqlashfienkyndkpffivehpqimsplakyhrtkpglterlemfi
    cgkevlnaytelndpfkqkecfklqqkdrekgdteaaqldsafctsleyglpptgglglg
    idritmfltnknsikdvilfptmrpan
    

    Sequence, based on observed residues (ATOM records): (download)
    >6agtD (D:)
    dprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitgr
    imrvsklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpgkskkg
    elsifpketillsaclhmlpmkeiryrqryldllinessrhtfvtrtkiinflrnflner
    gffevetpmmnliagganarpfithhndldldlylriatelplkmlivggidkvyeigkv
    frnegidnthnpeftscefywayadyndlikwsedffsqlvyhlfgtykisynkdgpenq
    pieidftppypkvsiveeiekvtntileqpfdsnetiekminiikehkielpnpptaakl
    ldqlashfienkyndkpffivehpqimsplakyhrtkpglterlemficgkevlnaytel
    ndpfkqkecfklqqkdrqldsafctsleyglpptgglglgidritmfltnknsikdvilf
    ptmrp