SCOPe 2.08: Domain d6agtb2: 6agt B:229-583

Lineage for d6agtb2 (6agt B:229-583)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.0: automated matches [227172] (1 protein)
   not a true family

6. Protein automated matches [226887] (24 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:5843] [354075] (9 PDB entries)

8. Domain d6agtb2: 6agt B:229-583 [365731]
   Other proteins in same PDB: d6agta1, d6agtb1, d6agtc1, d6agtd1
   automated match to d3bjua2
   complexed with 9x0, co, fmt, lys, mla

Details for d6agtb2

PDB Entry: 6agt, 1.95 Å

PDB Description: crystal structure of pfkrs complexed with chromone inhibitor

PDB Compounds: (B:) Lysine--tRNA ligase

SCOPe Domain Sequences for d6agtb2:

Sequence; same for both SEQRES and ATOM records:

>d6agtb2 d.104.1.0 (B:229-583) automated matches {Plasmodium falciparum [TaxId: 5843]}
dteiryrqryldllinessrhtfvtrtkiinflrnflnergffevetpmmnliagganar
pfithhndldldlylriatelplkmlivggidkvyeigkvfrnegidnthnpeftscefy
wayadyndlikwsedffsqlvyhlfgtykisynkdgpenqpieidftppypkvsiveeie
kvtntileqpfdsnetiekminiikehkielpnpptaaklldqlashfienkyndkpffi
vehpqimsplakyhrtkpglterlemficgkevlnaytelndpfkqkecfklqqkdrekg
dteaaqldsafctsleyglpptgglglgidritmfltnknsikdvilfptmrpan

Timeline for d6agtb2:

• d6agtb2 first appeared in SCOPe 2.07