SCOPe 2.08: Domain d6ilha2: 6ilh A:222-575

Lineage for d6ilha2 (6ilh A:222-575)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.0: automated matches [227172] (1 protein)
   not a true family

6. Protein automated matches [226887] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225403] (12 PDB entries)

8. Domain d6ilha2: 6ilh A:222-575 [365357]
   Other proteins in same PDB: d6ilha1, d6ilhb1
   automated match to d3bjua2
   complexed with kaa; mutant

Details for d6ilha2

PDB Entry: 6ilh, 2.5 Å

PDB Description: crystal structure of human lysyl-trna synthetase l350h mutant

PDB Compounds: (A:) Lysine-tRNA ligase

SCOPe Domain Sequences for d6ilha2:

Sequence; same for both SEQRES and ATOM records:

>d6ilha2 d.104.1.0 (A:222-575) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dketryrqryldlilndfvrqkfiirskiityirsfldelgfleietpmmniipggavak
pfityhneldmnlymriapelyhkmlvvggidrvyeigrqfrnegidlthnpefttcefy
mayadyhdhmeitekmvsgmvkhitgsykvtyhpdgpegqaydvdftppfrrinmveele
kalgmklpetnlfeteetrkilddicvakavecppprttarlldklvgeflevtcinptf
icdhpqimsplakwhrskeglterfelfvmkkeicnaytelndpmrqrqlfeeqakakaa
gddeamfidenfctaleyglpptagwgmgidrvamfltdsnnikevllfpamkp

Timeline for d6ilha2:

• d6ilha2 first appeared in SCOPe 2.07